Structure of PDB 7zhg Chain P

Receptor sequence
>7zhgP (length=55) Species: 272844 (Pyrococcus abyssi GE5) [Search protein sequence]
AKADYNKRKPRKFGKGARRCIRCGQYGPIIRIHGLMLCRHCFREVAPKLG
FRKYE
3D structure
PDB7zhg Role of aIF5B in archaeal translation initiation.
ChainP
Resolution2.25 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P A2 K3 Y6 N7 K8 R9 K10 R12 K13 F14 K16 G17 C24 Q26 R32 R40 H41 R44 E45 Y55 E56 A1 K2 Y5 N6 K7 R8 K9 R11 K12 F13 K15 G16 C23 Q25 R31 R39 H40 R43 E44 Y54 E55
BS02 ZN P C24 C39 C42 C23 C38 C41
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zhg, PDBe:7zhg, PDBj:7zhg
PDBsum7zhg
PubMed35694843
UniProtP62012|RS14Z_PYRAB Small ribosomal subunit protein uS14 (Gene Name=rps14)

[Back to BioLiP]