Structure of PDB 7xxf Chain P

Receptor sequence
>7xxfP (length=50) Species: 1071 (Rhodopila globiformis) [Search protein sequence]
SITGLTEAEAKEFHGIFITSFIVFTVIAIVAHLLAWQWRPWLPAVTGYGT
3D structure
PDB7xxf An LH1-RC photocomplex from an extremophilic phototroph provides insight into origins of two photosynthesis proteins.
ChainP
Resolution2.24 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide P S26 I33 V36 L40 Q43 W44 S20 I27 V30 L34 Q37 W38
BS02 peptide P H20 I24 F27 I28 H38 L39 W47 L48 H14 I18 F21 I22 H32 L33 W41 L42
BS03 BCL P A34 A37 H38 A28 A31 H32
BS04 BCL P F27 F30 A34 H38 W47 F21 F24 A28 H32 W41
BS05 I7D P F19 I22 F23 S26 F27 F13 I16 F17 S20 F21
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7xxf, PDBe:7xxf, PDBj:7xxf
PDBsum7xxf
PubMed36344631
UniProtA0A2S6NEL9

[Back to BioLiP]