Structure of PDB 7wtw Chain P

Receptor sequence

>7wtwP (length=121) Species: 9606 (Homo sapiens) [Search protein sequence]

FTYRGVDLDQLLDMSYEQLMQLYSARQRRRLNRGLRRKQHSLLKRLRKAK
KEAPPMEKPEVVKTHLRDMIILPEMVGSMVGVYNGKTFNQVEIKPEMIGH
YLGEFSITYKPVKHSRFIPLK

3D structure

PDB

7wtw The nucleoplasmic phase of pre-40S formation prior to nuclear export.

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	R18 S38 A39 R40 R42 R43 R44 R47 R50 R59 K77 H79 R81 D82 Y97 G99 K100 F102 Y115 G117 T122 V126 K127 H128	R4 S24 A25 R26 R28 R29 R30 R33 R36 R45 K63 H65 R67 D68 Y83 G85 K86 F88 Y101 G103 T108 V112 K113 H114

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0097371	MDM2/MDM4 family protein binding
GO:1990948	ubiquitin ligase inhibitor activity

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0000056	ribosomal small subunit export from nucleus
GO:0001649	osteoblast differentiation
GO:0002181	cytoplasmic translation
GO:0006364	rRNA processing
GO:0006412	translation
GO:0042274	ribosomal small subunit biogenesis
GO:0097421	liver regeneration
GO:1901798	positive regulation of signal transduction by p53 class mediator

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0005925	focal adhesion
GO:0015935	small ribosomal subunit
GO:0016020	membrane
GO:0022626	cytosolic ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0045202	synapse
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7wtw, PDBe:7wtw, PDBj:7wtw
PDBsum	7wtw
PubMed	36321656
UniProt	P62841\|RS15_HUMAN Small ribosomal subunit protein uS19 (Gene Name=RPS15)