Structure of PDB 7w59 Chain P

Receptor sequence
>7w59P (length=113) Species: 9606 (Homo sapiens) [Search protein sequence]
TTAARPTFEPARGGRGKQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNR
DFRRELEERERAAAREKNRDRWDDDVVFKNCAKGVDDQKKDKRFVNDTLR
SEFHKKFMEKYIK
3D structure
PDB7w59 Mechanism of exon ligation by human spliceosome.
ChainP
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P S32 R33 P36 S37 H38 S25 R26 P29 S30 H31
BS02 rna P T2 T3 R6 T8 A12 R33 T1 T2 R5 T7 A11 R26
BS03 rna P A5 R6 P7 F9 A4 R5 P6 F8
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045292 mRNA cis splicing, via spliceosome
Cellular Component
GO:0000974 Prp19 complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005739 mitochondrion
GO:0016607 nuclear speck
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7w59, PDBe:7w59, PDBj:7w59
PDBsum7w59
PubMed35705093
UniProtQ9P013|CWC15_HUMAN Spliceosome-associated protein CWC15 homolog (Gene Name=CWC15)

[Back to BioLiP]