Structure of PDB 7vot Chain P

Receptor sequence
>7votP (length=43) Species: 272943 (Cereibacter sphaeroides 2.4.1) [Search protein sequence]
LGYTGLTDEQAQELHSVYMSGLWLFSAVAIVAHLAVYIWRPWF
3D structure
PDB7vot Structural basis for the assembly and quinone transport mechanisms of the dimeric photosynthetic RC-LH1 supercomplex.
ChainP
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SPO P V34 A41 V42 W45 V28 A35 V36 W39
BS02 BCL P F31 A35 A38 V42 F25 A29 A32 V36
BS03 SPO P E19 L20 V23 G27 L28 F31 E13 L14 V17 G21 L22 F25
BS04 BCL P A35 H39 V42 W48 A29 H33 V36 W42
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7vot, PDBe:7vot, PDBj:7vot
PDBsum7vot
PubMed35418573
UniProtQ3J1A3|LHB1_CERS4 Light-harvesting protein B-875 beta chain (Gene Name=pufB)

[Back to BioLiP]