Structure of PDB 7v2m Chain P

Receptor sequence

>7v2mP (length=81) Species: 300852 (Thermus thermophilus HB8)

MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLK
VDVERARYWLSVGAQPTDTARRLLRQAGVFR

3D structure

• PDB: 7v2m Decoding the Mechanism of Specific RNA Targeting by Ribosomal Methyltransferases.
• Chain: P
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	M1 V2 K3 R5 L6 G10 S11 K12 H13 R18 R25 K27 R28 K31 I33 Y38 R42 K43 V62 G63 T69 R75 R81	M1 V2 K3 R5 L6 G10 S11 K12 H13 R18 R25 K27 R28 K31 I33 Y38 R42 K43 V62 G63 T69 R75 R81

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7v2m, PDBe:7v2m, PDBj:7v2m
• PDBsum: 7v2m
• PubMed: 35316014
• UniProt: Q5SJH3|RS16_THET8 Small ribosomal subunit protein bS16 (Gene Name=rpsP)