Structure of PDB 7unr Chain P

Receptor sequence

>7unrP (length=120) Species: 208964 (Pseudomonas aeruginosa PAO1)

MRHRKSGRHLSRTSAHRKAMFQNMAVSLFEHELIKTTLPKAKELRRVAEP
LITLAKEDSVANRRLAFDRTRSKAAVGKLFNDLGKRYANRPGGYLRILKC
GFRAGDNAPMAYVELVDRPV

3D structure

• PDB: 7unr Compact IF2 allows initiator tRNA accommodation into the P site and gates the ribosome to elongation
• Chain: P
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	M1 R2 H3 R4 K5 S6 R8 H9 S11 R12 S14 H16 K18 N23 H31 I34 K35 T36 P39 K42 R45 T53 R63 R64 F67 D68 R69 R71 K73 R90 P91 G92 G93 R96 K99 R103 G105 D106 N107	M1 R2 H3 R4 K5 S6 R8 H9 S11 R12 S14 H16 K18 N23 H31 I34 K35 T36 P39 K42 R45 T53 R63 R64 F67 D68 R69 R71 K73 R90 P91 G92 G93 R96 K99 R103 G105 D106 N107

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7unr, PDBe:7unr, PDBj:7unr
• PDBsum: 7unr
• UniProt: O52761|RL17_PSEAE Large ribosomal subunit protein bL17 (Gene Name=rplQ)