Structure of PDB 7u47 Chain P

Receptor sequence
>7u47P (length=91) Species: 9606 (Homo sapiens) [Search protein sequence]
QGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLAL
QEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGL
3D structure
PDB7u47 CENP-N promotes the compaction of centromeric chromatin.
ChainP
Resolution7.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna P R72 W86 T120 R28 W42 T76
BS02 dna P R63 L65 R19 L21
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003682 chromatin binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0000132 establishment of mitotic spindle orientation
GO:0000281 mitotic cytokinesis
GO:0034080 CENP-A containing chromatin assembly
GO:0051301 cell division
GO:0051382 kinetochore assembly
GO:0061644 protein localization to CENP-A containing chromatin
GO:0071459 protein localization to chromosome, centromeric region
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000779 condensed chromosome, centromeric region
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005721 pericentric heterochromatin
GO:0005829 cytosol
GO:0043505 CENP-A containing nucleosome
GO:0061638 CENP-A containing chromatin

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7u47, PDBe:7u47, PDBj:7u47
PDBsum7u47
PubMed35422519
UniProtP49450|CENPA_HUMAN Histone H3-like centromeric protein A (Gene Name=CENPA)

[Back to BioLiP]