Structure of PDB 7r7a Chain P

Receptor sequence

>7r7aP (length=183) Species: 1247190 (Saccharomyces cerevisiae BY4741)

ARYGATSTNPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQKYLEQV
LDHQRAIPFRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAAAN
AEAKGLDATKLYVSHIQVNQAPKQRRRTYRAHGRINKYESSPSHIELVVT
EKEEAVAKAAEKKVVRLTSRQRGRIAAQKRIAA

3D structure

• PDB: 7r7a Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
• Chain: P
• Resolution: 3.04 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	R3 Y4 S16 R18 Y21 S25 F26 K27 R30 Q34 R62 F63 S65 G68 R69 A71 Q72 K74 K80 R82 W83 P84 A85 K86 N97 N101 Q118 V119 Q121 T129 Y139 E140 S141 R167 T169 S170 R171 Q172 R173 G174 R175 A178 R181 I182	R2 Y3 S15 R17 Y20 S24 F25 K26 R29 Q33 R61 F62 S64 G67 R68 A70 Q71 K73 K79 R81 W82 P83 A84 K85 N96 N100 Q117 V118 Q120 T128 Y138 E139 S140 R166 T168 S169 R170 Q171 R172 G173 R174 A177 R180 I181
BS02	rna	P	R3 Y4 G5 A6 R61 R62 N120 Q121 P123 H145	R2 Y3 G4 A5 R60 R61 N119 Q120 P122 H144

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7r7a, PDBe:7r7a, PDBj:7r7a
• PDBsum: 7r7a
• PubMed: 36482249
• UniProt: P05740|RL17A_YEAST Large ribosomal subunit protein uL22A (Gene Name=RPL17A)