Structure of PDB 7r72 Chain P

Receptor sequence
>7r72P (length=51) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]
RVSFKNTRETQVLDHFNSSIGRKARWPAKSVKFRRRTYRAHGRINKYESS
P
3D structure
PDB7r72 Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
ChainP
Resolution3.07 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P S25 K27 N28 F63 S65 G68 R82 W83 P84 K86 R127 T129 Y139 E140 S141 S3 K5 N6 F16 S18 G21 R25 W26 P27 K29 R35 T37 Y47 E48 S49
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7r72, PDBe:7r72, PDBj:7r72
PDBsum7r72
PubMed36482249
UniProtP05740|RL17A_YEAST Large ribosomal subunit protein uL22A (Gene Name=RPL17A)

[Back to BioLiP]