Structure of PDB 7q0p Chain P

Receptor sequence

>7q0pP (length=127) Species: 237561 (Candida albicans SC5314)

SQVFGVARIFASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAA
MLAAQDVAAKCKEVGITAVHIKLRATGGTKTKTPGPGGQSALRALARSGL
RIGRIEDVTPVPSDSTRRKGGRRGRRL

3D structure

• PDB: 7q0p E-site drug specificity of the human pathogen Candida albicans ribosome.
• Chain: P
• Resolution: 2.77 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	R13 N19 D20 F22 H24 S29 G30 K31 E32 T33 R36 T38 G40 M41 D46 R47 E49 R79 G83 V116 P117 S118 X119 S120 T121 R122 K124 G125 G126 R127 R128 R130 R131 L132	R8 N14 D15 F17 H19 S24 G25 K26 E27 T28 R31 T33 G35 M36 D41 R42 E44 R74 G78 V111 P112 S113 X114 S115 T116 R117 K119 G120 G121 R122 R123 R125 R126 L127

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0030445 yeast-form cell wall
• GO:0030446 hyphal cell wall
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7q0p, PDBe:7q0p, PDBj:7q0p
• PDBsum: 7q0p
• PubMed: 35613268
• UniProt: A0A1D8PDT3|RS14B_CANAL Small ribosomal subunit protein uS11 (Gene Name=RPS14B)