Structure of PDB 7pwg Chain P

Receptor sequence

>7pwgP (length=154) Species: 184922 (Giardia lamblia ATCC 50803) [Search protein sequence]

VKYAFKSDNLLVGKSRRDGVKASFKNTYSTCRAIKGMGVKRAFAYLDNVL
NHKEIVPFFKFYKGVGRHSQARGSGTDKGRWPEKSVVVVKDILKQAVSNA
KHAHKKEEDELYVISYCVNRARGRRRRTFRAHGRISKYESQPCHVELIVG
PKPL

3D structure

PDB

7pwg Cryo-EM structure of the ancient eukaryotic ribosome from the human parasite Giardia lamblia.

Chain

Resolution

2.75 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	Y4 K15 S16 R17 R18 S24 K26 Y29 K36 K61 F62 Y63 K64 G65 G67 R68 H69 S70 Q71 R73 G74 D78 R81 W82 E84 K85 Q96 N100 H103 Y117 C118 V119 R125 R127 F130 R131 A132 H133 G134 I136 S137 K138 Y139 E140 S141 Q142	Y3 K14 S15 R16 R17 S23 K25 Y28 K35 K60 F61 Y62 K63 G64 G66 R67 H68 S69 Q70 R72 G73 D77 R80 W81 E83 K84 Q95 N99 H102 Y116 C117 V118 R124 R126 F129 R130 A131 H132 G133 I135 S136 K137 Y138 E139 S140 Q141
BS02	rna	P	V2 K3 A5 K7 R33 F60 N120	V1 K2 A4 K6 R32 F59 N119

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7pwg, PDBe:7pwg, PDBj:7pwg
PDBsum	7pwg
PubMed	35100413
UniProt	A8BE76

[Back to BioLiP]