Structure of PDB 7po3 Chain P

Receptor sequence
>7po3P (length=97) Species: 9606 (Homo sapiens) [Search protein sequence]
SNEDLPISMENPYKEPLKKCILCGKHVDYKNVQLLSQFVSPFTGCIYGRH
ITGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKDPKVCNIRYRE
3D structure
PDB7po3 Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
ChainP
Resolution2.92 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P C90 I91 G93 R94 H95 Q104 K105 T108 K109 K112 R113 I116 M117 V122 C45 I46 G48 R49 H50 Q59 K60 T63 K64 K67 R68 I71 M72 V77
BS02 FES P C65 C68 C100 K102 K103 C20 C23 C55 K57 K58
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7po3, PDBe:7po3, PDBj:7po3
PDBsum7po3
PubMed35676484
UniProtQ9Y3D5|RT18C_HUMAN Small ribosomal subunit protein bS18m (Gene Name=MRPS18C)

[Back to BioLiP]