Structure of PDB 7pnv Chain P

Receptor sequence
>7pnvP (length=97) Species: 10090 (Mus musculus) [Search protein sequence]
SNEDLPVPMENPYKEPLKKCVLCEKRVDYKNVQLLSQFISPFTGCIYGRH
ITGLCGKKQREITKAIKRAQKMGFMPVTYKDPAYLKDPRVCNIRYRE
3D structure
PDB7pnv Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
ChainP
Resolution3.06 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P C91 I92 Y93 G94 R95 H96 Q105 R106 T109 K110 K113 R114 K117 M118 V123 C45 I46 Y47 G48 R49 H50 Q59 R60 T63 K64 K67 R68 K71 M72 V77
BS02 FES P C66 C69 C101 K104 C20 C23 C55 K58
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pnv, PDBe:7pnv, PDBj:7pnv
PDBsum7pnv
PubMed35676484
UniProtQ8R2L5|RT18C_MOUSE Small ribosomal subunit protein bS18m (Gene Name=Mrps18c)

[Back to BioLiP]