Structure of PDB 7pnu Chain P

Receptor sequence
>7pnuP (length=97) Species: 10090 (Mus musculus) [Search protein sequence]
SNEDLPVPMENPYKEPLKKCVLCEKRVDYKNVQLLSQFISPFTGCIYGRH
ITGLCGKKQREITKAIKRAQKMGFMPVTYKDPAYLKDPRVCNIRYRE
3D structure
PDB7pnu Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
ChainP
Resolution3.06 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P C91 I92 R95 H96 R106 T109 K110 K113 R114 K117 M118 C45 I46 R49 H50 R60 T63 K64 K67 R68 K71 M72
BS02 FES P C66 C69 C101 K104 C20 C23 C55 K58
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pnu, PDBe:7pnu, PDBj:7pnu
PDBsum7pnu
PubMed35676484
UniProtQ8R2L5|RT18C_MOUSE Small ribosomal subunit protein bS18m (Gene Name=Mrps18c)

[Back to BioLiP]