Structure of PDB 7pit Chain P

Receptor sequence
>7pitP (length=83) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
KRNQRKVLIGIVKSTKNAKTATVQVESRFKHPLYHKSVVRHKKYQAHNEG
EVLAKDGDKVQIVETRPLSATKRFRIAKIIERA
3D structure
PDB7pit Visualizing translation dynamics at atomic detail inside a bacterial cell.
ChainP
Resolution5.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P K2 N4 Q5 R6 K7 K17 F30 H36 R41 H42 K43 Y45 Q46 E50 E52 E65 R67 P68 L69 S70 A71 T72 K73 R74 R76 K1 N3 Q4 R5 K6 K16 F29 H35 R40 H41 K42 Y44 Q45 E49 E51 E64 R66 P67 L68 S69 A70 T71 K72 R73 R75
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pit, PDBe:7pit, PDBj:7pit
PDBsum7pit
PubMed36171285
UniProtQ50309|RS17_MYCPN Small ribosomal subunit protein uS17 (Gene Name=rpsQ)

[Back to BioLiP]