Structure of PDB 7pir Chain P

Receptor sequence
>7pirP (length=83) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
KRNQRKVLIGIVKSTKNAKTATVQVESRFKHPLYHKSVVRHKKYQAHNEG
EVLAKDGDKVQIVETRPLSATKRFRIAKIIERA
3D structure
PDB7pir Visualizing translation dynamics at atomic detail inside a bacterial cell.
ChainP
Resolution12.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P K2 R3 N4 Q5 K7 V8 K17 N18 A19 K20 T21 R29 F30 H36 K43 Y45 E50 E52 E65 R67 P68 L69 S70 A71 T72 K73 R74 A84 K1 R2 N3 Q4 K6 V7 K16 N17 A18 K19 T20 R28 F29 H35 K42 Y44 E49 E51 E64 R66 P67 L68 S69 A70 T71 K72 R73 A83
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pir, PDBe:7pir, PDBj:7pir
PDBsum7pir
PubMed36171285
UniProtQ50309|RS17_MYCPN Small ribosomal subunit protein uS17 (Gene Name=rpsQ)

[Back to BioLiP]