Structure of PDB 7phb Chain P

Receptor sequence
>7phbP (length=83) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
KRNQRKVLIGIVKSTKNAKTATVQVESRFKHPLYHKSVVRHKKYQAHNEG
EVLAKDGDKVQIVETRPLSATKRFRIAKIIERA
3D structure
PDB7phb Visualizing translation dynamics at atomic detail inside a bacterial cell.
ChainP
Resolution4.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P K2 R3 N4 Q5 K17 R29 L34 R41 H42 K43 Q46 E65 R67 P68 L69 S70 A71 K73 R74 K1 R2 N3 Q4 K16 R28 L33 R40 H41 K42 Q45 E64 R66 P67 L68 S69 A70 K72 R73
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7phb, PDBe:7phb, PDBj:7phb
PDBsum7phb
PubMed36171285
UniProtQ50309|RS17_MYCPN Small ribosomal subunit protein uS17 (Gene Name=rpsQ)

[Back to BioLiP]