Structure of PDB 7ohx Chain P

Receptor sequence

>7ohxP (length=127) Species: 559292 (Saccharomyces cerevisiae S288C)

NPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQKYLEQVLDHQRAIP
FRRFNRTAQGKEKARWPAKSVKFVQGLLQNAAANAEAKGLDATKLYVSHI
QVNQAPKESSPSHIELVVTEKEEAVAK

3D structure

• PDB: 7ohx Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
• Chain: P
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	S16 A17 R18 S20 Y21 S25 F26 K27 R30 Q34 K43 R62 F63 R69 K74 P84 A85 K86 N97 A100 N101 Q118 V119 Q121 K124 S141 K153 V157 A158 K159	S7 A8 R9 S11 Y12 S16 F17 K18 R21 Q25 K34 R53 F54 R56 K61 P67 A68 K69 N80 A83 N84 Q101 V102 Q104 K107 S109 K121 V125 A126 K127
BS02	rna	P	R61 Q118 N120 Q121	R52 Q101 N103 Q104

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7ohx, PDBe:7ohx, PDBj:7ohx
• PDBsum: 7ohx
• PubMed: 34813592
• UniProt: P05740|RL17A_YEAST Large ribosomal subunit protein uL22A (Gene Name=RPL17A)