Structure of PDB 7ohs Chain P

Receptor sequence

>7ohsP (length=137) Species: 559292 (Saccharomyces cerevisiae S288C)

NPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQKYLEQVLDHQRAIP
FRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAAANAEAKGLDA
TKLYVSHIQVNQAPKESSPSHIELVVTEKEEAVAKAA

3D structure

• PDB: 7ohs Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
• Chain: P
• Resolution: 4.38 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	S16 R18 G19 S20 Y21 R23 S25 F26 K27 R30 Q34 F63 S65 S66 R69 K74 K80 A85 Q96 N97 A100 N101 K105 Q118 Q121 E140 S141 E155 V157 A158 K159	S7 R9 G10 S11 Y12 R14 S16 F17 K18 R21 Q25 F54 S56 S57 R60 K65 K71 A76 Q87 N88 A91 N92 K96 Q109 Q112 E116 S117 E131 V133 A134 K135
BS02	rna	P	R61 R62 Q118 N120 P123	R52 R53 Q109 N111 P114

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7ohs, PDBe:7ohs, PDBj:7ohs
• PDBsum: 7ohs
• PubMed: 34813592
• UniProt: P05740|RL17A_YEAST Large ribosomal subunit protein uL22A (Gene Name=RPL17A)