Structure of PDB 7ohq Chain P

Receptor sequence

>7ohqP (length=177) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

ARYGATSTNPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQKYLEQV
LDHQRAIPFRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAAAN
AEAKGLDATKLYVSHIQVNQAPKQRRRTYRAHGRINKYESSPSHIELVVT
EKEEAKKVVRLTSRQRGRIAAQKRIAA

3D structure

PDB

7ohq Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	R3 Y4 S16 A17 R18 Y21 R23 S25 F26 K27 Q34 Q50 Q55 R62 F63 S65 S66 I67 G68 R69 A71 Q72 K74 E75 T79 K80 R82 W83 P84 K86 N97 A100 N101 H116 Q118 V119 Q121 Q125 R126 R127 Y130 R131 A132 H133 G134 I136 N137 K138 Y139 E140 S141 S142 R167 T169 S170 R171 Q172 G174 R175 A178 R181 I182	R2 Y3 S15 A16 R17 Y20 R22 S24 F25 K26 Q33 Q49 Q54 R61 F62 S64 S65 I66 G67 R68 A70 Q71 K73 E74 T78 K79 R81 W82 P83 K85 N96 A99 N100 H115 Q117 V118 Q120 Q124 R125 R126 Y129 R130 A131 H132 G133 I135 N136 K137 Y138 E139 S140 S141 R160 T162 S163 R164 Q165 G167 R168 A171 R174 I175
BS02	rna	P	R3 Y4 A6 R61 R62 N120 Q121	R2 Y3 A5 R60 R61 N119 Q120

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000448	cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:0030687	preribosome, large subunit precursor
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7ohq, PDBe:7ohq, PDBj:7ohq
PDBsum	7ohq
PubMed	34813592
UniProt	P05740\|RL17A_YEAST Large ribosomal subunit protein uL22A (Gene Name=RPL17A)

[Back to BioLiP]