Structure of PDB 7ohp Chain P

Receptor sequence
>7ohpP (length=98) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
NPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQKYLEQVLWPAKSVK
FVQGLLQNAAANAEAKGLDATKLYVSHIQVNQAPKESSPSHIELVVTE
3D structure
PDB7ohp Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
ChainP
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P R18 G19 Y21 S25 F26 K27 R30 Q34 W83 Q96 N97 N101 V119 Q121 E140 R9 G10 Y12 S16 F17 K18 R21 Q25 W44 Q57 N58 N62 V80 Q82 E86
BS02 rna P Q118 N120 Q121 A122 P123 Q79 N81 Q82 A83 P84
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ohp, PDBe:7ohp, PDBj:7ohp
PDBsum7ohp
PubMed34813592
UniProtP05740|RL17A_YEAST Large ribosomal subunit protein uL22A (Gene Name=RPL17A)

[Back to BioLiP]