Structure of PDB 7ods Chain P

Receptor sequence
>7odsP (length=144) Species: 9606 (Homo sapiens) [Search protein sequence]
DPVENEAVAPEFTNRNPRNLELLSVARKERGWRTVFPSREFWHRLRVIRT
QHHVEALVEHQNGKVVVSASTREWAIKKHLYSTRNVVACESIGRVLAQRC
LEAGINFMVYQPTPWEAASDSMKRLQSAMTEGGVVLREPQRIYE
3D structure
PDB7ods Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
ChainP
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P R66 Y179 E180 R30 Y143 E144
BS02 rna P T86 Q87 H88 H89 R108 W110 K113 R120 V122 S155 S157 T50 Q51 H52 H53 R72 W74 K77 R84 V86 S119 S121
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
GO:0035928 rRNA import into mitochondrion
Cellular Component
GO:0005615 extracellular space
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ods, PDBe:7ods, PDBj:7ods
PDBsum7ods
PubMed34135320
UniProtQ9H0U6|RM18_HUMAN Large ribosomal subunit protein uL18m (Gene Name=MRPL18)

[Back to BioLiP]