Structure of PDB 7o5b Chain P

Receptor sequence
>7o5bP (length=88) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
AVKIRLKRMGAKKSPFYRIVVADSRSPRDGRFIETVGTYNPVAKPAEVKI
DEELALKWLQTGAKPSDTVRNLFSSQGIMEKFHNAKQG
3D structure
PDB7o5b Inhibition of SRP-dependent protein secretion by the bacterial alarmone (p)ppGpp.
ChainP
Resolution3.33 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P A2 V3 R6 L7 R9 M10 G11 K13 K14 F17 R19 R26 R29 G31 R32 K45 T62 S67 T69 R71 N72 S75 M80 E81 A1 V2 R5 L6 R8 M9 G10 K12 K13 F16 R18 R25 R28 G30 R31 K44 T61 S66 T68 R70 N71 S74 M79 E80
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7o5b, PDBe:7o5b, PDBj:7o5b
PDBsum7o5b
PubMed35217658
UniProtP21474|RS16_BACSU Small ribosomal subunit protein bS16 (Gene Name=rpsP)

[Back to BioLiP]