Structure of PDB 7nhn Chain P

Receptor sequence

>7nhnP (length=133) Species: 169963 (Listeria monocytogenes EGD-e)

LVPKRVKYRREFRGNMRGRAKGGTEVAFGEYGLQAVEASWITNRQIEAAR
IAMTRYMKRGGKVWIKIFPHKSYTSKPIGVRMGKGKGAPEGWVSPVKRGK
IMFEIAGVPEDVAREALRLAAHKLPVKTKIVKR

3D structure

• PDB: 7nhn Structural basis of ABCF-mediated resistance to pleuromutilin, lincosamide, and streptogramin A antibiotics in Gram-positive pathogens.
• Chain: P
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	K5 R6 K8 Y9 R11 F13 R14 G15 N16 R18 K22 R45 R56 F69 H71 S76 K77 G80 R82 M83 G84 K85 G86 K87 R119 H123 K124 P126 K128	K4 R5 K7 Y8 R10 F12 R13 G14 N15 R17 K21 R44 R55 F68 H70 S75 K76 G79 R81 M82 G83 K84 G85 K86 R118 H122 K123 P125 K127
BS02	rna	P	N16 M17 R18 G19	N15 M16 R17 G18

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7nhn, PDBe:7nhn, PDBj:7nhn
• PDBsum: 7nhn
• PubMed: 34117249
• UniProt: Q927L4|RL16_LISMO Large ribosomal subunit protein uL16 (Gene Name=rplP)