Structure of PDB 7nhm Chain P

Receptor sequence

>7nhmP (length=135) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325)

LLPKRVKYRRQHRPKTTGRSKGGNYVTFGEFGLQATTTSWITSRQIESAR
IAMTRYMKRGGKVWIKIFPHTPYTKKPLEVRMGAGKGAVEGWIAVVKPGR
ILFEVAGVSEEVAREALRLASHKLPVKTKFVKREE

3D structure

• PDB: 7nhm Structural basis of ABCF-mediated resistance to pleuromutilin, lincosamide, and streptogramin A antibiotics in Gram-positive pathogens.
• Chain: P
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	P4 K5 R6 K8 Y9 R11 H13 R14 K16 K22 G24 W41 R45 Q46 S49 R56 K63 H71 K76 K77 E80 V81 R82 M83 G84 G86 K87 R119 L120 H123 K124 K128	P3 K4 R5 K7 Y8 R10 H12 R13 K15 K21 G23 W40 R44 Q45 S48 R55 K62 H70 K75 K76 E79 V80 R81 M82 G83 G85 K86 R118 L119 H122 K123 K127
BS02	rna	P	T17 T18 G19	T16 T17 G18

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7nhm, PDBe:7nhm, PDBj:7nhm
• PDBsum: 7nhm
• PubMed: 34117249
• UniProt: Q2FW13|RL16_STAA8 Large ribosomal subunit protein uL16 (Gene Name=rplP)