Structure of PDB 7du2 Chain P

Receptor sequence
>7du2P (length=130) Species: 9606 (Homo sapiens) [Search protein sequence]
KFLQSKAETARESKQNPMIQRNSSFASSHEVWKYICELGISKVELSMEDI
ETILNTLIYDGKVEMTIIAAKEGTVGSVDGHMKLYRAVNPIIPPTGLVRA
PCGLCPVFDDCHEGGEISPSNCIYMTEWLE
3D structure
PDB7du2 Structure of human RNA polymerase III elongation complex.
ChainP
Resolution3.35 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 SF4 P C287 C290 F293 P304 C307 C102 C105 F108 P119 C122
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
GO:0005515 protein binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0006359 regulation of transcription by RNA polymerase III
GO:0006383 transcription by RNA polymerase III
GO:0032728 positive regulation of interferon-beta production
GO:0045087 innate immune response
GO:0045089 positive regulation of innate immune response
GO:0051607 defense response to virus
Cellular Component
GO:0000428 DNA-directed RNA polymerase complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005666 RNA polymerase III complex
GO:0005829 cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7du2, PDBe:7du2, PDBj:7du2
PDBsum7du2
PubMed33674783
UniProtQ9H1D9|RPC6_HUMAN DNA-directed RNA polymerase III subunit RPC6 (Gene Name=POLR3F)

[Back to BioLiP]