Structure of PDB 7c08 Chain P

Receptor sequence
>7c08P (length=192) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence]
ASHLASIYGTEQDKVNCSFYYKIGACRHGERCYRKHVKPNFSQTILCPNM
YKNPIHEPNGKKFTQRELAEQFDAFYEDMFCEFSKYGEVEQLVVCDNVGD
HLVGNVYVRFKYEESAQNAIDDLNSRWYSQRPVYAELSPVTDFREACCRQ
HETSECQRGGLCNFMHAKKPSPQLLRDLVLAQRKYLALNAAE
3D structure
PDB7c08 Elucidation of the aberrant 3' splice site selection by cancer-associated mutations on the U2AF1.
ChainP
Resolution3.35 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P T11 E12 F20 H29 C33 Y34 E146 C148 R150 R159 N164 F165 T10 E11 F19 H28 C32 Y33 E145 C147 R149 R158 N163 F164
BS02 ZN P C18 C27 C33 H37 C17 C26 C32 H36
BS03 ZN P C149 C157 C163 H167 C148 C156 C162 H166
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030628 pre-mRNA 3'-splice site binding
GO:0046872 metal ion binding
Biological Process
GO:0000389 mRNA 3'-splice site recognition
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045292 mRNA cis splicing, via spliceosome
Cellular Component
GO:0000243 commitment complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005829 cytosol
GO:0071004 U2-type prespliceosome
GO:0089701 U2AF complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7c08, PDBe:7c08, PDBj:7c08
PDBsum7c08
PubMed32958768
UniProtQ09176|U2AF1_SCHPO Splicing factor U2AF 23 kDa subunit (Gene Name=SPAP8A3.06)

[Back to BioLiP]