Structure of PDB 7abg Chain P

Receptor sequence

>7abgP (length=162) Species: 9606 (Homo sapiens)

WEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPGVRMR
FKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQVRDAGDMLLKLARTTPYYK
RNRPHICSFWVKGECKRGEECPYRHEKPTDPDDPLADQNIKDRYYGINDP
VADKLLKRASTM

3D structure

• PDB: 7abg Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
• Chain: P
• Resolution: 7.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	C84 L193 Q196	C70 L135 Q138
BS02	rna	P	M63 R64 H163 S166 F167 E172 C173 K174 R175 P180 Y181	M49 R50 H105 S108 F109 E114 C115 K116 R117 P122 Y123

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0017070 U6 snRNA binding
• GO:0036002 pre-mRNA binding
• GO:0046872 metal ion binding
• GO:0048306 calcium-dependent protein binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:0033120 positive regulation of RNA splicing
• GO:0042307 positive regulation of protein import into nucleus
• GO:0045292 mRNA cis splicing, via spliceosome
• GO:0046827 positive regulation of protein export from nucleus
• GO:0071466 cellular response to xenobiotic stimulus

Cellular Component

• GO:0000974 Prp19 complex
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0005737 cytoplasm
• GO:0071006 U2-type catalytic step 1 spliceosome
• GO:0071007 U2-type catalytic step 2 spliceosome
• GO:0071013 catalytic step 2 spliceosome

External links

• PDB: RCSB:7abg, PDBe:7abg, PDBj:7abg
• PDBsum: 7abg
• PubMed: 33243851
• UniProt: Q9NW64|RBM22_HUMAN Pre-mRNA-splicing factor RBM22 (Gene Name=RBM22)