Structure of PDB 7a5p Chain P

Receptor sequence
>7a5pP (length=90) Species: 9606 (Homo sapiens) [Search protein sequence]
TMPRLDPPEDKTITTLYVGGLGDTITETDLRNHFYQFGEIRTITVVQRQQ
CAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQAA
3D structure
PDB7a5p Structural Insights into the Roles of Metazoan-Specific Splicing Factors in the Human Step 1 Spliceosome.
ChainP
Resolution5.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P N299 V300 N81 V82
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0017070 U6 snRNA binding
GO:0036002 pre-mRNA binding
GO:0046872 metal ion binding
GO:0048306 calcium-dependent protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0033120 positive regulation of RNA splicing
GO:0042307 positive regulation of protein import into nucleus
GO:0045292 mRNA cis splicing, via spliceosome
GO:0046827 positive regulation of protein export from nucleus
GO:0071466 cellular response to xenobiotic stimulus
Cellular Component
GO:0000974 Prp19 complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005737 cytoplasm
GO:0071006 U2-type catalytic step 1 spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7a5p, PDBe:7a5p, PDBj:7a5p
PDBsum7a5p
PubMed33007253
UniProtQ9NW64|RBM22_HUMAN Pre-mRNA-splicing factor RBM22 (Gene Name=RBM22)

[Back to BioLiP]