Structure of PDB 7a5p Chain P |
>7a5pP (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] |
TMPRLDPPEDKTITTLYVGGLGDTITETDLRNHFYQFGEIRTITVVQRQQ CAFIQFATRQAAEVAAEKSFNKLIVNGRRLNVKWGRSQAA |
|
PDB | 7a5p Structural Insights into the Roles of Metazoan-Specific Splicing Factors in the Human Step 1 Spliceosome. |
Chain | P |
Resolution | 5.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
P |
N299 V300 |
N81 V82 |
|
|
|
|