Structure of PDB 7a18 Chain P

Receptor sequence

>7a18P (length=129) Species: 243230 (Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539)

QTFRNKKQRKQQVKLRKPGFAVAKYVRMSPRKVRLVVDVIRGKSVQDAED
LLRFIPRSASEPVAKVLNSAKANALHNDEMLEDRLFVKEAYVDAGPTLKR
LIPRARGSANIIKKRTSHITIIVAEKGNK

3D structure

• PDB: 7a18 Ribosome-binding and anti-microbial studies of the mycinamicins, 16-membered macrolide antibiotics from Micromonospora griseorubida.
• Chain: P
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	R9 K11 K12 R14 K15 Q16 K19 R21 K22 V27 Y30 R32 S34 R36 K37 R62 K70 N73 S74 A77 N78 H81 N82 D98 A99 R105 P108 R109 A110 R111 G112 S113 A114 N115 I117 K118 K119 R120	R4 K6 K7 R9 K10 Q11 K14 R16 K17 V22 Y25 R27 S29 R31 K32 R57 K65 N68 S69 A72 N73 H76 N77 D93 A94 R100 P103 R104 A105 R106 G107 S108 A109 N110 I112 K113 K114 R115

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7a18, PDBe:7a18, PDBj:7a18
• PDBsum: 7a18
• PubMed: 34417608
• UniProt: Q9RXJ7|RL22_DEIRA Large ribosomal subunit protein uL22 (Gene Name=rplV)