Structure of PDB 6zoo Chain P |
>6zooP (length=99) Species: 3888 (Pisum sativum) [Search protein sequence] |
VEVLLGASDGGLAFVPSSLEVSAGETIVFKNNAGFPHNVVFDEDEIPAGV DASKISMPEEDLLNAPGETYSVKLDAKGTYKFYCSPHQGAGMVGQVTVN |
|
PDB | 6zoo Structure of plant photosystem I-plastocyanin complex reveals strong hydrophobic interactions. |
Chain | P |
Resolution | 2.74 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
P |
H37 C84 H87 M92 |
H37 C84 H87 M92 |
|
|
|
|