Structure of PDB 6ylx Chain P

Receptor sequence

>6ylxP (length=176) Species: 4932 (Saccharomyces cerevisiae)

ARYGATSTNPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQKYLEQV
LDHQRAIPFRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAAAN
AEAKGLDATKLYVSHIQVNQAPKQRRRTYRAHGRINKYESSPSHIELVVT
EKEEKKVVRLTSRQRGRIAAQKRIAA

3D structure

• PDB: 6ylx Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
• Chain: P
• Resolution: 3.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	R3 Y21 R23 S25 K27 R30 Q34 Q55 R62 F63 S65 S66 G68 R69 T70 A71 Q72 K74 K80 R82 W83 P84 K86 N101 H116 Q118 V119 R127 Y130 R131 A132 G134 R135 E140 S141 R167 T169 S170 R171 Q172 G174 R175 R181 I182	R2 Y20 R22 S24 K26 R29 Q33 Q54 R61 F62 S64 S65 G67 R68 T69 A70 Q71 K73 K79 R81 W82 P83 K85 N100 H115 Q117 V118 R126 Y129 R130 A131 G133 R134 E139 S140 R159 T161 S162 R163 Q164 G166 R167 R173 I174
BS02	rna	P	R3 G5 A6 R62 N120 Q121 P123	R2 G4 A5 R61 N119 Q120 P122

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6ylx, PDBe:6ylx, PDBj:6ylx
• PDBsum: 6ylx
• PubMed: 32668200
• UniProt: P05740|RL17A_YEAST Large ribosomal subunit protein uL22A (Gene Name=RPL17A)