Structure of PDB 6ylg Chain P

Receptor sequence

>6ylgP (length=171) Species: 4932 (Saccharomyces cerevisiae)

ARYGATSTNPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQKYLEQV
LDHQRAIPFRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAAAN
AEAKGLDATKLYVSHIQVNQAPKQRRRTYRAHGRINKYESSPSHIELVVT
EKEVVRLTSRQRGRIAAQKRI

3D structure

• PDB: 6ylg Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
• Chain: P
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	Y4 Y21 R23 S25 F26 K27 R30 Q34 Q55 R62 F63 S65 S66 I67 G68 R69 A71 K74 T79 K80 R82 W83 P84 K86 N97 N101 Q118 V119 R126 R127 T129 Y130 R131 A132 H133 G134 R135 I136 N137 K138 Y139 E140 S141 R167 T169 S170 R171 Q172 G174 R175 I182	Y3 Y20 R22 S24 F25 K26 R29 Q33 Q54 R61 F62 S64 S65 I66 G67 R68 A70 K73 T78 K79 R81 W82 P83 K85 N96 N100 Q117 V118 R125 R126 T128 Y129 R130 A131 H132 G133 R134 I135 N136 K137 Y138 E139 S140 R156 T158 S159 R160 Q161 G163 R164 I171
BS02	rna	P	R3 G5 R61 R62 Q121 P123	R2 G4 R60 R61 Q120 P122

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6ylg, PDBe:6ylg, PDBj:6ylg
• PDBsum: 6ylg
• PubMed: 32668200
• UniProt: P05740|RL17A_YEAST Large ribosomal subunit protein uL22A (Gene Name=RPL17A)