Structure of PDB 6xiq Chain P

Receptor sequence

>6xiqP (length=183) Species: 4932 (Saccharomyces cerevisiae)

ARYGATSTNPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQKYLEQV
LDHQRAIPFRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAAAN
AEAKGLDATKLYVSHIQVNQAPKQRRRTYRAHGRINKYESSPSHIELVVT
EKEEAVAKAAEKKVVRLTSRQRGRIAAQKRIAA

3D structure

• PDB: 6xiq Structural impact of K63 ubiquitin on yeast translocating ribosomes under oxidative stress.
• Chain: P
• Resolution: 4.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	K27 R30 Q50 Q55 R56 R62 S66 I67 R69 Q72 G77 K80 R82 W83 K86 N97 N101 H116 Q118 Q121 Y130 R131 A132 H133 G134 R135 I136 N137 Y139 S141 T169 R171 R175 A178 R181	K26 R29 Q49 Q54 R55 R61 S65 I66 R68 Q71 G76 K79 R81 W82 K85 N96 N100 H115 Q117 Q120 Y129 R130 A131 H132 G133 R134 I135 N136 Y138 S140 T168 R170 R174 A177 R180
BS02	rna	P	R3 Y4 G5 R61 R62 N120 P123 R126	R2 Y3 G4 R60 R61 N119 P122 R125

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6xiq, PDBe:6xiq, PDBj:6xiq
• PDBsum: 6xiq
• PubMed: 32855298
• UniProt: P05740|RL17A_YEAST Large ribosomal subunit protein uL22A (Gene Name=RPL17A)