Structure of PDB 6w6k Chain P

Receptor sequence
>6w6kP (length=79) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
MVTIRLARHGAKKRPFYQVVVADSRNARNGRFIERVGFFNPIASEKEEGT
RLDLDRIAHWVGQGATISDRVAALIKEVN
3D structure
PDB6w6k Alternative conformations and motions adopted by 30S ribosomal subunits visualized by cryo-electron microscopy.
ChainP
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P M1 R5 L6 K12 K13 R14 P15 F16 D23 S24 R25 R28 G30 F32 P41 K46 Q63 G64 R70 K76 M1 R5 L6 K12 K13 R14 P15 F16 D23 S24 R25 R28 G30 F32 P41 K46 Q63 G64 R70 K76
Gene Ontology
Molecular Function
GO:0000400 four-way junction DNA binding
GO:0003735 structural constituent of ribosome
GO:0004519 endonuclease activity
GO:0004520 DNA endonuclease activity
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006259 DNA metabolic process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6w6k, PDBe:6w6k, PDBj:6w6k
PDBsum6w6k
PubMed32989043
UniProtP0A7T3|RS16_ECOLI Small ribosomal subunit protein bS16 (Gene Name=rpsP)

[Back to BioLiP]