Structure of PDB 6swa Chain P

Receptor sequence

>6swaP (length=185) Species: 10090 (Mus musculus)

DIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFM
SRTNRPPLSLSRMIRKMKLPGRENKTAVVVGTVTDDVRILEVPKLKVCAL
RVSSRARSRILKAGGKILTFDQLALESPKGRGTVLLSGPRKGREVYRHFG
KAPGTPHSHTKPYVRSKGRKFERARGRRASRGYKN

3D structure

• PDB: 6swa Protein Synthesis in the Developing Neocortex at Near-Atomic Resolution Reveals Ebp1-Mediated Neuronal Proteostasis at the 60S Tunnel Exit.
• Chain: P
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	H7 N8 R11 K12 V13 R14 R15 S20 R26 K30 F34 R37 R38 T42 F43 M53 S54 R55 T56 N57 P60 S62 S64 R65 R68 K69 K71 L72 P73 R75 K78 T85 T87 D88 D89 R91 R104 S107 R108 R134 G135 T136 L138 S140 R143 K144 G145 R146 E147 V148 R150 F152 T158 H162 K164 Y166 V167 R168 S169 K170 R172 K173 R176 R178 R180 R181 S183 Y186 K187 N188	H4 N5 R8 K9 V10 R11 R12 S17 R23 K27 F31 R34 R35 T39 F40 M50 S51 R52 T53 N54 P57 S59 S61 R62 R65 K66 K68 L69 P70 R72 K75 T82 T84 D85 D86 R88 R101 S104 R105 R131 G132 T133 L135 S137 R140 K141 G142 R143 E144 V145 R147 F149 T155 H159 K161 Y163 V164 R165 S166 K167 R169 K170 R173 R175 R177 R178 S180 Y183 K184 N185

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005783 endoplasmic reticulum
• GO:0005791 rough endoplasmic reticulum
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6swa, PDBe:6swa, PDBj:6swa
• PDBsum: 6swa
• PubMed: 33357414
• UniProt: P35980|RL18_MOUSE Large ribosomal subunit protein eL18 (Gene Name=Rpl18)