Structure of PDB 6ppp Chain P

Receptor sequence

>6pppP (length=94) Species: 284812 (Schizosaccharomyces pombe 972h-)

MSLADFMEQRVQVITNDGRVVLGSLKGFDHTTNLILSDSFERIISMDQDM
ETIPLGVYLLRGENVAMVGLVNEELDSEIEWTKIRGEAIPDVVH

3D structure

• PDB: 6ppp Molecular basis for the distinct cellular functions of the Lsm1-7 and Lsm2-8 complexes.
• Chain: P
• Resolution: 2.33 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	T31 N33 R61 E63	T31 N33 R61 E63

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0005515 protein binding
• GO:0030620 U2 snRNA binding
• GO:0140691 RNA folding chaperone

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:0034337 RNA folding
• GO:1905323 telomerase holoenzyme complex assembly

Cellular Component

• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0005682 U5 snRNP
• GO:0005686 U2 snRNP
• GO:0005688 U6 snRNP
• GO:0005697 telomerase holoenzyme complex
• GO:0032991 protein-containing complex
• GO:0046540 U4/U6 x U5 tri-snRNP complex
• GO:0071011 precatalytic spliceosome
• GO:0120115 Lsm2-8 complex

External links

• PDB: RCSB:6ppp, PDBe:6ppp, PDBj:6ppp
• PDBsum: 6ppp
• PubMed: 32518066
• UniProt: O74483|LSM8_SCHPO U6 snRNA-associated Sm-like protein LSm8 (Gene Name=lsm8)