Structure of PDB 6neq Chain P

Receptor sequence
>6neqP (length=116) Species: 9913 (Bos taurus) [Search protein sequence]
KAYRGGHLTIRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQLGSYDPMPN
SHGEKLVALNLDRIRHWIGCGAHLSKPVEKLLGLSGFFPLHPMVITNAER
LRRKRAQEVLLAAQKT
3D structure
PDB6neq Structure of Human Mitochondrial Translation Initiation Factor 3 Bound to the Small Ribosomal Subunit.
ChainP
Resolution3.32 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P K10 A11 Y12 R13 G15 H16 R20 L23 C26 T27 N28 Y32 H38 N39 P42 R43 D44 G45 R46 F47 C79 G80 A81 H82 S84 P86 M102 K1 A2 Y3 R4 G6 H7 R11 L14 C17 T18 N19 Y23 H29 N30 P33 R34 D35 G36 R37 F38 C70 G71 A72 H73 S75 P77 M93
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6neq, PDBe:6neq, PDBj:6neq
PDBsum6neq
PubMed30677741
UniProtP82915|RT16_BOVIN Small ribosomal subunit protein bS16m (Gene Name=MRPS16)

[Back to BioLiP]