Structure of PDB 6lkq Chain P

Receptor sequence
>6lkqP (length=80) Species: 562 (Escherichia coli) [Search protein sequence]
KIRTLQGRVVSDKMEKSIVVAIERFVKHPIYGKFIKRTTKLHVHDENNEC
GIGDVVEIRECRPLSKTKSWTLVRVVEKAV
3D structure
PDB6lkq The structural basis for inhibition of ribosomal translocation by viomycin.
ChainP
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P K15 E17 K18 F27 I32 Y33 K35 K38 R39 T40 T41 K42 L43 H44 E62 R64 P65 L66 S67 K68 S71 W72 K13 E15 K16 F25 I30 Y31 K33 K36 R37 T38 T39 K40 L41 H42 E60 R62 P63 L64 S65 K66 S69 W70
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 19:38:38 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6lkq', asym_id = 'P', title = 'The structural basis for inhibition of ribosomal translocation by viomycin.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6lkq', asym_id='P', title='The structural basis for inhibition of ribosomal translocation by viomycin.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '6lkq', asym_id = 'P'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='6lkq', asym_id='P')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>