Structure of PDB 6hma Chain P

Receptor sequence
>6hmaP (length=102) Species: 1280 (Staphylococcus aureus) [Search protein sequence]
MFAIIETGGKQIKVEEGQEIFVEKLDVNEGDTFTFDKVLFVGGDSVKVGA
PTVEGATVTATVNKQGRGKKITVFTYKRRKNSKRKKGHRQPYTKLTIDKI
NA
3D structure
PDB6hma Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus
ChainP
Resolution2.65 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P G9 K10 F21 E23 R67 K69 K70 Y76 R78 R79 K80 K83 R84 K85 K86 H88 Q90 Y92 G9 K10 F21 E23 R67 K69 K70 Y76 R78 R79 K80 K83 R84 K85 K86 H88 Q90 Y92
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6hma, PDBe:6hma, PDBj:6hma
PDBsum6hma
PubMed
UniProtQ2FXS8|RL21_STAA8 Large ribosomal subunit protein bL21 (Gene Name=rplU)

[Back to BioLiP]