Structure of PDB 6h3m Chain P

Receptor sequence

>6h3mP (length=30) Species: 9606 (Homo sapiens)

FVNQHLCGSHLVEALYLVCGERGFFYTPKT

3D structure

• PDB: 6h3m Substitution of an Internal Disulfide Bridge with a Diselenide Enhances both Foldability and Stability of Human Insulin.
• Chain: P
• Resolution: 1.821 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	P	G8 E13 Y16 G23 F24 F25 Y26 T27 P28	G8 E13 Y16 G23 F24 F25 Y26 T27 P28
BS02	peptide	P	F1 V2	F1 V2
BS03	peptide	P	N3 L6 H10 Y16 L17 G20 E21	N3 L6 H10 Y16 L17 G20 E21
BS04	peptide	P	H5 L6 C7 A14 L15 V18 C19 R22 K29	H5 L6 C7 A14 L15 V18 C19 R22 K29

Gene Ontology

Molecular Function

• GO:0005179 hormone activity

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:6h3m, PDBe:6h3m, PDBj:6h3m
• PDBsum: 6h3m
• PubMed: 31012517
• UniProt: P01308|INS_HUMAN Insulin (Gene Name=INS)