Structure of PDB 6gqb Chain P

Receptor sequence

>6gqbP (length=183) Species: 559292 (Saccharomyces cerevisiae S288C)

ARYGATSTNPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQKYLEQV
LDHQRAIPFRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAAAN
AEAKGLDATKLYVSHIQVNQAPKQRRRTYRAHGRINKYESSPSHIELVVT
EKEEAVAKAAEKKVVRLTSRQRGRIAAQKRIAA

3D structure

• PDB: 6gqb Structural Insights into the Role of Diphthamide on Elongation Factor 2 in mRNA Reading-Frame Maintenance.
• Chain: P
• Resolution: 3.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	R3 A17 R18 Y21 S25 K27 N28 R30 Q34 Q55 R56 R62 S65 S66 I67 R69 T70 Q72 K74 E75 K80 R82 W83 K86 A100 N101 Q118 V119 Q121 R127 R128 Y130 R131 A132 H133 G134 I136 N137 K138 Y139 E140 S141 T169 R171 Q172 R175 R181 I182	R2 A16 R17 Y20 S24 K26 N27 R29 Q33 Q54 R55 R61 S64 S65 I66 R68 T69 Q71 K73 E74 K79 R81 W82 K85 A99 N100 Q117 V118 Q120 R126 R127 Y129 R130 A131 H132 G133 I135 N136 K137 Y138 E139 S140 T168 R170 Q171 R174 R180 I181
BS02	rna	P	R3 Y4 A6 R61 R62 N120 Q121 P123	R2 Y3 A5 R60 R61 N119 Q120 P122

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6gqb, PDBe:6gqb, PDBj:6gqb
• PDBsum: 6gqb
• PubMed: 29886014
• UniProt: P05740|RL17A_YEAST Large ribosomal subunit protein uL22A (Gene Name=RPL17A)