Structure of PDB 6gq1 Chain P

Receptor sequence

>6gq1P (length=183) Species: 559292 (Saccharomyces cerevisiae S288C)

ARYGATSTNPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQKYLEQV
LDHQRAIPFRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAAAN
AEAKGLDATKLYVSHIQVNQAPKQRRRTYRAHGRINKYESSPSHIELVVT
EKEEAVAKAAEKKVVRLTSRQRGRIAAQKRIAA

3D structure

• PDB: 6gq1 Structural Insights into the Role of Diphthamide on Elongation Factor 2 in mRNA Reading-Frame Maintenance.
• Chain: P
• Resolution: 4.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	R3 Y4 S16 A17 R18 Y21 S25 K27 R30 Q55 R56 F63 S65 S66 G68 R69 A71 Q72 G77 K80 R82 W83 P84 A85 K86 N97 A100 N101 H116 Q118 V119 Q121 R126 R127 Y130 R131 A132 H133 G134 N137 K138 Y139 E140 S141 R167 T169 R171 Q172 R175 A178 R181 I182	R2 Y3 S15 A16 R17 Y20 S24 K26 R29 Q54 R55 F62 S64 S65 G67 R68 A70 Q71 G76 K79 R81 W82 P83 A84 K85 N96 A99 N100 H115 Q117 V118 Q120 R125 R126 Y129 R130 A131 H132 G133 N136 K137 Y138 E139 S140 R166 T168 R170 Q171 R174 A177 R180 I181
BS02	rna	P	R3 Y4 G5 A6 R61 R62 N120 P123	R2 Y3 G4 A5 R60 R61 N119 P122

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6gq1, PDBe:6gq1, PDBj:6gq1
• PDBsum: 6gq1
• PubMed: 29886014
• UniProt: P05740|RL17A_YEAST Large ribosomal subunit protein uL22A (Gene Name=RPL17A)