Structure of PDB 6fec Chain P

Receptor sequence

>6fecP (length=266) Species: 9606 (Homo sapiens)

CRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRR
IRSINKLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKS
KTVYSILRHVAEVLEYTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKH
AVSDPSILDSLDLNEDEREVLINNINRRLTPQAVKIRADIEVACYGYEGI
DAVKEALRAGLNCSTETMPIKINLIAPPRYVMTTTTLERTEGLSVLNQAM
AVIKEKIEEKRGVFNV

3D structure

• PDB: 6fec Structure of a human cap-dependent 48S translation pre-initiation complex.
• Chain: P
• Resolution: 6.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	R53 R54 R55 R57	R48 R49 R50 R52
BS02	rna	P	R55 R57	R50 R52
BS03	rna	P	K61 L62 I63 R64 K106 T107 S110 R113 E120 T122 R182 R183 L184 T185 Q187 R192 I230	K56 L57 I58 R59 K101 T102 S105 R108 E115 T117 R177 R178 L179 T180 Q182 R187 I225

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Feb 21 18:05:23 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6fec', asym_id = 'P', title = 'Structure of a human cap-dependent 48S translation pre-initiation complex.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6fec', asym_id='P', title='Structure of a human cap-dependent 48S translation pre-initiation complex.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003676,0003723,0003743', uniprot = '', pdbid = '6fec', asym_id = 'P'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003676,0003723,0003743', uniprot='', pdbid='6fec', asym_id='P')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>