Structure of PDB 6ci9 Chain P

Receptor sequence

>6ci9P (length=255) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

SHMFTSLEGRSAIVTGGSKGIGRGIAETFANAGVDVVITGRNQDDLDRTV
ADLSGTRGKVTAVRADVTDPEDARRTVAETVSRHGGLDIVCANAGIFPSG
RLEDLTPDDIEQVLGVNFKGTVYIVQAALQALTASGHGRVVVTSSITGPI
TGYPGWSHYGASKAAQLGFLRTAAMELAPKKITINAVLPGNIMTEGLDEM
GQDYLDQMASAIPAGRLGSVADIGNAALFFATDEAAYVTGQTLVVDGGQV
LPESH

3D structure

• PDB: 6ci9 Structure and Kinetics of the S-(+)-1-Amino-2-propanol Dehydrogenase from the RMM Microcompartment of Mycobacterium smegmatis.
• Chain: P
• Resolution: 1.9 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): G18 S143 Y157
• Catalytic site (residue number reindexed from 1): G20 S145 Y159
• Enzyme Commision number: 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	P	G14 S16 K17 G18 I19 R39 N40 D64 V65 N91 G93 T141 S143 Y157 K161 P187 G188 N189 I190 T192 G194 L195	G16 S18 K19 G20 I21 R41 N42 D66 V67 N93 G95 T143 S145 Y159 K163 P189 G190 N191 I192 T194 G196 L197
BS02	F3V	P	F95 S143 T145 W154 Y157 G188	F97 S145 T147 W156 Y159 G190

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0004316 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity
• GO:0016491 oxidoreductase activity

External links

• PDB: RCSB:6ci9, PDBe:6ci9, PDBj:6ci9
• PDBsum: 6ci9
• PubMed: 29757625
• UniProt: A0QP46