Structure of PDB 6boh Chain P

Receptor sequence

>6bohP (length=110) Species: 262724 (Thermus thermophilus HB27)

RLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSAS
SLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALA
EGAREGGLEF

3D structure

• PDB: 6boh Conformational Control of Translation Termination on the 70S Ribosome.
• Chain: P
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	R3 R9 R10 F12 R13 N16 R17 T21 R23 R89 Y94 R106 F112	R1 R7 R8 F10 R11 N14 R15 T19 R21 R87 Y92 R104 F110
BS02	rna	P	R10 R15 K19 R25 F29 S31 L32 K33 Y36 Q38 V46 T47 S50 L54 A55 N61 K62 T63 Y92 K93 H95 G96 R97	R8 R13 K17 R23 F27 S29 L30 K31 Y34 Q36 V44 T45 S48 L52 A53 N59 K60 T61 Y90 K91 H93 G94 R95

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6boh, PDBe:6boh, PDBj:6boh
• PDBsum: 6boh
• PubMed: 29731232
• UniProt: Q72I20|RL18_THET2 Large ribosomal subunit protein uL18 (Gene Name=rplR)