Structure of PDB 5z3g Chain P

Receptor sequence
>5z3gP (length=108) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
RVKVHFDQAGKKVSRRNARATRAAKIAPRPLDLLRPVVRAPTVKYNRKVR
AGRGFTLAEVKAAGLTAAYARTIGIAVDHRRQNRNQEIFDANVQRLKEYQ
SKIIVFPR
3D structure
PDB5z3g Cryo-EM structure of an early precursor of large ribosomal subunit reveals a half-assembled intermediate.
ChainP
Resolution3.65 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna P Q28 A29 K32 R35 R36 R39 R42 R55 V58 R59 P61 T62 V63 Y65 N66 K68 R70 G72 R73 R91 D98 H99 R100 R104 N105 Q8 A9 K12 R15 R16 R19 R22 R35 V38 R39 P41 T42 V43 Y45 N46 K48 R50 G52 R53 R71 D78 H79 R80 R84 N85
BS02 rna P F26 D27 S34 F6 D7 S14
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5z3g, PDBe:5z3g, PDBj:5z3g
PDBsum5z3g
PubMed29557065
UniProtQ12690|RL13A_YEAST Large ribosomal subunit protein eL13A (Gene Name=RPL13A)

[Back to BioLiP]