Structure of PDB 5t2a Chain P

Receptor sequence

>5t2aP (length=154) Species: 5661 (Leishmania donovani)

THYSRKPQVSSKSAKAKVSDLRCHYKNTFETANVINGMPLRKAQQLYRQV
LAKTRCIPFKRYNGKIGRTAQAKEWGQTKGRWPRKSVVAMMSLLKNAEAN
AIEKGLDPNQMVIKHVQVDQAARMRRRTYRAHGRITPYMCSPCHVQLFMS
EKKE

3D structure

• PDB: 5t2a Structures and stabilization of kinetoplastid-specific split rRNAs revealed by comparing leishmanial and human ribosomes.
• Chain: P
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	T2 Y4 S5 R6 K16 K18 R23 H25 Y26 K27 F30 R42 R49 Q50 L52 T55 R62 Y63 G65 K66 R82 R85 M92 K96 N97 A100 N101 N110 Q118 V119 D120 R127 R131 A132 H133 G134 Y139	T1 Y3 S4 R5 K15 K17 R22 H24 Y25 K26 F29 R41 R48 Q49 L51 T54 R61 Y62 G64 K65 R81 R84 M91 K95 N96 A99 N100 N109 Q117 V118 D119 R126 R130 A131 H132 G133 Y138
BS02	rna	P	H25 G65 K66 I67 G68 R69 T79 K80 R82 W83 P84 R85 K86 Y130 R131 G134 I136 P138 Y139 M140 C141	H24 G64 K65 I66 G67 R68 T78 K79 R81 W82 P83 R84 K85 Y129 R130 G133 I135 P137 Y138 M139 C140
BS03	rna	P	T2 H3 S5 R62	T1 H2 S4 R61
BS04	rna	P	K7 S12	K6 S11
BS05	rna	P	Q46 R69 A71 Q72 K74	Q45 R68 A70 Q71 K73

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5t2a, PDBe:5t2a, PDBj:5t2a
• PDBsum: 5t2a
• PubMed: 27752045
• UniProt: A0A3S7WY02