Structure of PDB 5nmi Chain P

Receptor sequence

>5nmiP (length=372) Species: 9913 (Bos taurus)

HPLMKIVNNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTS
DTTTAFSSVTHICRDVNYGWIIRYMHANGASMFFICLYMHVGRGLYYGSY
TFLETWNIGVILLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIG
TNLVEWIWGGFSVDKATLTRFFAFHFILPFIIMAIAMVHLLFLHETGSNN
PTGISSDVDKIPFHPYYTIKDILGALLLILALMLLVLFAPDLLGDPDNYT
PANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAFSILILALIPLL
HTSKQRSMMFRPLSQCLFWALVADLLTLTWIGGQPVEHPYITIGQLASVL
YFLLILVLMPTAGTIENKLLKW

3D structure

• PDB: 5nmi New paradigms for understanding and step changes in treating active and chronic, persistent apicomplexan infections.
• Chain: P
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	P	Q44 I45 G48 L49 Y55 R80 H83 A84 A87 T126 G130 L133 P134 H182 F183 P186	Q37 I38 G41 L42 Y48 R73 H76 A77 A80 T119 G123 L126 P127 H175 F176 P179
BS02	HEM	P	W31 G34 L37 L94 H97 R100 S106 W113 G116 V117 H196 L197 L200 N206	W24 G27 L30 L87 H90 R93 S99 W106 G109 V110 H189 L190 L193 N199
BS03	MJM	P	F18 L21 I27 G38 L197 S205 F220	F11 L14 I20 G31 L190 S198 F213

Gene Ontology

Molecular Function

• GO:0008121 ubiquinol-cytochrome-c reductase activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:0048039 ubiquinone binding

Biological Process

• GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
• GO:0022904 respiratory electron transport chain
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0016020 membrane
• GO:0031966 mitochondrial membrane
• GO:0045275 respiratory chain complex III

External links

• PDB: RCSB:5nmi, PDBe:5nmi, PDBj:5nmi
• PDBsum: 5nmi
• PubMed: 27412848
• UniProt: P00157|CYB_BOVIN Cytochrome b (Gene Name=MT-CYB)